Pay in installments of $6.09 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 30 - Sep 4
For Your Every Summer RSVP, with Code: SUMMER15
Description
The Ozempic workout? The fitness world is catering to GLP 1 users Los Angeles Times GLP 1(7 36), amide107444 51 9HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR NH Buy Orlistat Weight Loss Capsules Superdrug Online Doctor Retatrutide vs Tirzepatide Compared PeptidesExplorer GLP 1 @costco Haul My go to picks that keep me fed, fueled, and feeling good on a GLP1 : Egg'wich breakfast sammies easy protein that doesn't upset my stomach @
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.2 ★★★★★
Based on 14 reviews
Sort
Product Reviews
★★★★★ 5
Plenty of power. Easy to use.
Size: 8" Edger New
I was amazed at the power of this edger. Due to health issues we couldn’t give our lawn adequate attention. It hadn’t been edged in over a year. This edger cut thru the heavy overgrown grass. Maintaining the edging now is a breeze. It uses the same 80 volt battery as my blower👍. The only negative is there is no edge guide, but once I got used to it, it’s not really needed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
★★★★★ 5
Great product, well made, would buy again!
Size: 8" Edger New
Great product, well made, would buy again!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 20, 2026
★★★★★ 5
Uses same battery as the rest of my equipment
Size: 8" Edger New
Since I already have and like the Greenworks mower, string trimmer and blower it only made sense to get the edger. Even better that I didn’t need to buy more batteries. I tried another name brand electric edger and returned it for not holding a charge. This one works great! There’s charge left in the battery after everything has been edged. I was concerned how easy it would be to control but fell in love with it first time I used it. To use just pop the battery in, flip the thumb lever, squeeze and edge. Not as noisy as gas powered equipment and no cords to pull. Feels sturdy in my hands and a good weight that’s enough to not pop up if it hits something but not too much to be heavy to carry back to the shed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 29, 2025
★★★★★ 5
First use was great!
I've used it just the one time today. I had previously "edged" with a string weedwhacker, so while the grass was cut back some, there wasn't a trench dug out. I did a gentle push and pull, taking on about 18" at a time to get a new trench dug next to the sidewalk edge. It did a great job! The entire unit was much heavier and sturdy looking than I was afraid it would be for the price, so pleasantly surprised. Assembly wasn't complicated, but it did take two of us to hold it steady because getting the screws to seat in the square hole and not have the cord in the way was a bit tricky. I'm a 70+ lady, not large and not athletic, but I was able to handle this edger with ease. Now, to see how long it lasts!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 11, 2025
★★★★★ 5
Not expensive
Gets the job done
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2026