Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 10 - Jul 15
For Your Every Summer RSVP, with Code: SUMMER15
Description
The Ozempic workout? The fitness world is catering to GLP 1 users Los Angeles Times GLP 1(7 36), amide107444 51 9HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR NH Buy Orlistat Weight Loss Capsules Superdrug Online Doctor Retatrutide vs Tirzepatide Compared PeptidesExplorer GLP 1 @costco Haul My go to picks that keep me fed, fueled, and feeling good on a GLP1 : Egg'wich breakfast sammies easy protein that doesn't upset my stomach @
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.0 ★★★★★
Based on 2036 reviews
Sort
Product Reviews
★★★★★ 4
Durable toy with a single squeaker
This goose seems to be made of fairly durable fabric. It's not flimsy. I had a hard time finding the squeaker in it at first, but then I realized the squeaker is located in the white neck!
My medium border collie grabbed it first. Then my pitbull figured out where the squeaker was and ran around squeaking it for a while, which is her favorite thing to do. So this toy did get some interest from the pitbull especially. She isn't one to chew things up but really enjoys toys that make noise. Since the squeaker is in the skinny neck portion, it made it easy for her to grab hold of it and squeak it over and over again.
I am giving this 4 stars only because in the whole long body of this toy, the neck has the only squeaker. I think it would have been better and more stimulating for my dogs if it had multiple squeakers or even some crinkles in the rest of the body...at least some crinkles in the flat feet of the duck. The sole attraction is that one squeaker in the neck. So it could be better, but I do like that it isn't super plush and full of stuffing that would be torn up in 5 minutes like most toys.
My pitbull actually took this to another room away from her three sisters, so that means she really wanted to play with this by herself. That's a good sign.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 28, 2025
★★★★★ 5
Duck-time is play-time! Exactly what a dog toy should be!
Duck hunting for your living-room princess-pal best buddy goodest puppy in the world!
Every dog deserves a chance to be a heroic duck hunting hero!
This dog toy is a favorite of my pup. Duck-time is play time! This duck is made with several fabulous textures. There's a ropey texture around the neck, a burlap type texture for the body and head, and a felt-like texture for the bill and feet.
My dog immediately tore the feet off! He always removes any hanging bits from all toys, so that's not a comment to the detriment of this product. He's working on the wings, now.
My dog likes to chase this toy when I throw it or play tug-of-war with it, or is willing to sit and chomp on it by himself for a while. The rope is intact, still!
This is exactly what a dog toy should be! Give your little buddy a hunting trophy!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 2, 2025
★★★★★ 2
Speaker broken
This toy is advertised as having a squeaker, but the one we had was defective and did not make any noise. Our dog still throughly enjoyed ripping this little duck to shreds through. The material was thicker than I was expecting but still only took our dog about 5 mins to completely destroy it (Golden retriever). I understand that this toy is marketed as for small dogs so I get that, but took away three starts because our came with the broken squeaker and for $10, you can find a lot better toys at TJ Max. This item is not a good value for our experience.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 1, 2025
★★★★★ 5
Durable duck toy for man’s best friend
Although it was suggested that this toy would be best for small breeds, I found that it’s durable enough for my 80 pound Irish setter! It has literally become his best friend. He takes it everywhere he goes! There’s a small squeaky noise that comes from the neck area that he has to work to find. I’m sure he will eventually destroy this as he has with all his other toys, but it’s really holding up much better than anticipated.
It is well worth the $10 cost.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 9, 2025
★★★★★ 5
Really cute, well made dog toy. Was a huge hit with our pup
This toy was a big hit!
Pros
- love the heavy duty burlap-kinda fabric. Our new puppy has razor sharp teeth but this fabric is holding up really well.
- size is great for a variety of breeds
- shape is perfect for grabbing onto. Our puppy especially likes picking it up on the neck where the toy is more slender
- the extra little feet and wing flaps add some interest that have really kept her occupied
Cons
- the squeaker is in the neck where the fabric has embellishments and is a little thicker. It's a little hard to activate the squeaker but maybe the toy/stuffing needs to get broken in more and then it will be easier to squeeze that section
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 29, 2025
recommand products
GHOST Vitamin C + Glutathione: Premium Antioxidant Protection Powered by Setria
23.49
Buy Organika Liposomal Glutathione at Well.ca
28.54
Micro Balance Health Products
20.45
Swanson Vitamins L-Glutathione Cream with Setria Glutathione
23.18
kyowa hakko glutathione Branded Ingredients-lbotoastmasters
24.93